PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G316900.2.p
Common NameSb01g030770, SORBIDRAFT_01g030770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 306aa    MW: 32702.2 Da    PI: 5.2673
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G316900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.95.7e-10161219563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  Sobic.001G316900.2.p 161 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 219
                           999*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-16157221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691159222IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-10161218No hitNo description
SuperFamilySSF579598.44E-11161212No hitNo description
PfamPF001702.3E-9161219IPR004827Basic-leucine zipper domain
CDDcd147031.32E-20162213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEAAGGWVLA PAAAGAGGGG DDLFNAYMSM EGMDGLNNSD GDSRGSSGMR TNGADSSENE  60
SEDYGGGGGG DSQFLLWGGD GGGKKKRNAS GEPAAAPAPP PARHARSHSM DSIMGKLSFS  120
SANGEPGKFS LEFGGGEFTP AEMKRIMADE KLAEMAMADP KRVKRVLANR QSAARSKERR  180
MRYIAELEQK VQILQTEATT LSAQLTLLQR DSAGLATQNN ELKFRLQAME QQAQLRDALN  240
EALTGEVQRL KLGDTGSSGN NLSQQMQLRC QNNQMVELNK QQQQGEQIPF YQLEQNGASR  300
NHEPK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352290.0BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465030.10.0hypothetical protein SORBIDRAFT_01g030770
SwissprotQ6S4P43e-50RF2B_ORYSJ; Transcription factor RF2b
TrEMBLC5WUH00.0C5WUH0_SORBI; Putative uncharacterized protein Sb01g030770
STRINGSb01g030770.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-56bZIP family protein